PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33098-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 315aa    MW: 32392.8 Da    PI: 8.0516
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33098-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.56.9e-391775260
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                     +e++++cprC+s ntkfCyynnys+sqPryfCkaCrryWt+GG+lrnvP+Ggg+rk k+
  TRIUR3_33098-P1 17 PEQKVECPRCKSGNTKFCYYNNYSMSQPRYFCKACRRYWTHGGSLRNVPIGGGCRKPKR 75
                     7899****************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-301575IPR003851Zinc finger, Dof-type
PfamPF027011.1E-321975IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6492175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAGEVTSAAE KKPRPKPEQK VECPRCKSGN TKFCYYNNYS MSQPRYFCKA CRRYWTHGGS  60
LRNVPIGGGC RKPKRPGTSE AHKLGVASSS EPTAVVPPST CTGMNFANVL PTFMSAGFEI  120
PSSLSLTAFG SSSSSNTAAV MSPGGTTSFL DVLRGGTGGL LDGSLSQNNG YYYGGPATGS  180
GIGMLMTPPV ASFGIPGPMQ QHGDLVVGGN GIGAATASIF QGGTGEEGDD GTGGVMGLQW  240
QPQVGNGGGA GVVSGGVHHL ETGNNVTMGN NNIHNNNNNN SGGDDNNGAS SRDYYWINNG  300
GSNPWQSLLN SSSLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ5447710.0KJ544771.1 Aegilops tauschii cultivar AS90 prolamin binding factor gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO244637e-39PBF_MAIZE; Dof zinc finger protein PBF
TrEMBLM7ZQ360.0M7ZQ36_TRIUA; Dof zinc finger protein PBF
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.15e-33TARGET OF MONOPTEROS 6